DPCstruct | MC21100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3VC26 | 5-81 | GQPHHPVRPGWFCRVDGQPWPCPPARATLLRDYDGDLVGLAVYLAGMLHDAVRDLYALNPDDAPTPAALWDRFLAWL |
| A0A561WTH8 | 3-73 | DPHDPVSPSWRCRDCGRDWPCPNRRQILLDEYRQQSTNLRVYLATCLTSATQDLAANPADLRDRFLGWVPH |
| A0A2W2CHM2 | 5-78 | None |
| A0A428XND1 | 25-96 | None |
| A0A3N1A2I3 | 4-80 | None |
| A0A1C4V6J3 | 17-105 | None |
| A0A2N3SCC2 | 101-176 | None |
| A0A2N3SI49 | 82-171 | None |
| A0A4Q7W9A9 | 10-80 | None |
| A0A4Q7WJ82 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.