DPCstruct | MC211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X1YB65 | 11-71 | ALVCSRKGCSADAVFGMLWNNPKLHTPERRKVWLSCPEHREYFREYLSSRGLLRGEVPVDE |
| A0A2P8E153 | 47-114 | ASSAAREPATCSAKGCRATAEYAVVWNNPKVHTPEREKVWAACGEHRQFLADFLEIRGFLLRVDPWTA |
| A0A6L5G960 | 1-60 | None |
| A0A0Q6RLS0 | 2-65 | None |
| A0A0M3T4B7 | 7-74 | None |
| A0A4Y4D6C1 | 17-91 | None |
| A0A1I4ISM9 | 6-76 | None |
| A0A1H1TF80 | 167-233 | None |
| A0A2W1YNV1 | 5-80 | None |
| A0A3N0CQR3 | 2-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.