DPCstruct | MC21099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 156 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2FPW3 | 17-171 | PVRSPAELSAELAAVTLHQVHAVALEAAATALMQVPGGLSADWAGYTAAPTTSPYTVTGRKFAELGAGGSALVVGSDGVSVKGPHGS… |
| A0A561WDP0 | 8-166 | LESAAQRELFGTAEFVPPDPPDRLRRFTARAARDLMAGWLSSAMVVVPHGTRPALPGTAEQACPRGSVQPSGEVYRPALLKRLGSKG… |
| A0A1C5JRL1 | 4-146 | None |
| A0A536KWI0 | 12-173 | None |
| A0A4R6L181 | 315-484 | None |
| A0A841DV04 | 1-155 | None |
| A0A6G7XLK0 | 336-496 | None |
| A0A1Q7TU34 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.