DPCstruct | MC21097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9JES2 | 485-587 | FAATKAYYQRILPCLNRTWYLALKKAGQPFRAPALIVYANTVKTPCGTERGTRGYYCGANQAIYMPFNVDYNNYKINPNYTRAWMLN… |
| A0A7V8HKN3 | 8-119 | QVSRDASRLSDVQHWSLKVLGSTERVWGPLFQQAGRQYQPTVLSFYSQSGVSGYGAAQSAMGPFYCPNDGKVYLDTDFFNELRQRFG… |
| F0GZ41 | 1-86 | None |
| A0A853QZN9 | 6-127 | None |
| A0A1I7AZM5 | 68-201 | None |
| A0A2X3KW54 | 38-163 | None |
| A0A4R2R2Q6 | 163-280 | None |
| A0A116NHH8 | 97-218 | None |
| A0A1H6U4X5 | 66-184 | None |
| A0A378AGE3 | 13-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.