DPCstruct | MC21096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 104 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.28 |
| Pfam Score | 88.33 |
| Assigned Pfam label(s) | PF02601- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538TYW2 | 64-166 | YSKERMRLRFDPTNGMAVDAYGRVSAYEPRGKCQLVVETMRPAGMGDRLLALEELKKKLQAEGLFDAARKRPLPRFPRRVGLVTSPV… |
| I7H4R1 | 6-99 | FKGNASKLRFQMQEGLNLIVRGSVSAYIPRGEYQINCLEVLPDGIGELSLTYQQLKTSLQARGYFDNKKPIPAFPKRVAVLTSITGA… |
| A0A410P756 | 55-167 | None |
| A0A809NGV3 | 1-113 | None |
| J5NP56 | 25-113 | None |
| A0A7Z7KQ19 | 2-97 | None |
| A0A660V2L8 | 66-165 | None |
| A0A2U1S974 | 61-170 | None |
| A0A7R9IW10 | 63-165 | None |
| A0A1T4V9H7 | 86-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.