DPCstruct | MC21094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353YG61 | 2-101 | TSQTLIVWGLYLASFFSLATTQIIGLIIAYVKRSDAAGTPFESHMIYAIRTFWIGLGIGLIGLILSVVGIGVVVLIGLIIWQLYRII… |
| A0A5A9Z427 | 2-95 | VVYAAFALGILLGGLPSIVGLIMAYVKRNEMTGTIYHGHMSMLIRTFWISLALGIIGALATFIYIGPLIIIGTGIWYIYRVVRGFIC… |
| A0A2T2X5H5 | 7-107 | None |
| A0A2Z3R9K4 | 8-110 | None |
| G4E704 | 119-233 | None |
| A0A3G2HTT4 | 14-118 | None |
| A0A5P1B4J6 | 2-87 | None |
| A0A1C3FFL2 | 19-139 | None |
| A0A536T5B0 | 24-138 | None |
| A0A2D9JL04 | 5-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.