DPCstruct | MC21091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 105 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2A675 | 31-127 | NNVDRLGEDYPIFAVVGNHDEDKWDGGSGYQAKLLDRMQNAIDDGAICEGEPGRNSVCTYKGLFMAMSGVGVMDGKDESADYLREQL… |
| A0A5C6ERP8 | 1-95 | MQINKILGPNFPYFASPGNRDIKCWNGEDGYQQYLKNRLNRLNIVWDGDLGVKSSAVQYKDIFIILVSPEEIGFGHASYIREQLAEN… |
| K8EBN1 | 4-133 | None |
| A0A0L0T4J1 | 1-129 | None |
| A0A534S7Q6 | 591-692 | None |
| A0A1G3BBN5 | 66-172 | None |
| A0A7T9HBG3 | 40-135 | None |
| A0A1Y2I293 | 285-392 | None |
| A0A848X9A1 | 596-706 | None |
| A0A075B0U3 | 28-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.