DPCstruct | MC21088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 312 ± 63 aa |
| Standard deviation of domain lengths | 62.56 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X1BN21 | 75-363 | ATRKSVKDILLDISQRHLPQRLKFAKSLKLLTKLCKSYLDDRTNQEYETVSLDDFFNIFYRLDRIFIIEFGGNVPKDCLDVKDAALE… |
| A0A2Z7AYC6 | 418-727 | MQKIASHIRNPSKFCKASKLAIQLIQAGSVKPTTSNHFFAILEGAMSTLSNCNDPSLRADYHALFSAAQDATDCLSKKQQNMLNSWT… |
| A0A0A9GVH5 | 2-324 | None |
| A0A830CKK1 | 3-231 | None |
| A0A388KLU1 | 129-445 | None |
| M7Z2T4 | 93-443 | None |
| K8EEW5 | 65-376 | None |
| A0A059LNT1 | 2-223 | None |
| A0A7S3QUX0 | 2-461 | None |
| A0A0K9QAJ3 | 98-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.