DPCstruct | MC21080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6LZJ2 | 19-165 | DEVEYLPEEDAVRYVAAWMHADHEAFVDGTNTEREPRYETTPFEQWAPTECARVGAERVLEVARDRLERGREEVRYGVSAEDGAETI… |
| A0A1H8PE91 | 62-197 | VDDPELDYLPEENAVRFPSLMNESSVVATDTMPFGRWSQLQCAEAALDPAWRVVEGHLDGDDTGLGRGVASSFPGMVVEFSHTITVD… |
| A0A2R6G7U1 | 9-144 | None |
| I3R632 | 89-231 | None |
| L9YFI3 | 1-121 | None |
| A0A1I4EGA9 | 63-198 | None |
| A0A1H8VIY2 | 68-229 | None |
| A0A1J4LTA1 | 173-346 | None |
| A0A2R6F5H5 | 67-200 | None |
| A0A6G8T732 | 55-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.