DPCstruct | MC2108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162ZWI2 | 1-107 | MLLSQSELQDIRAYQRTFEGAYWRTALSAFSMGLLILKVFTIEFYHIALAFFSFGVSMLLIAYMRHRQFKHVFDPAIPVKTSSNMVI… |
| A0A5N6Z6K5 | 16-133 | RARTVALTTDEIVEVRAAQRTFEGAYVRTALSQFSFALVVLKIFTSEFYSTGALFAIYGTGVLIIGLFRRQQGNQQFFAEVGEDGVH… |
| M5FNC5 | 14-152 | None |
| S8A3F5 | 1-149 | None |
| L7ITB9 | 58-207 | None |
| A0A397UG11 | 16-121 | None |
| A0A2N1J8Q8 | 28-154 | None |
| A0A4U6XLM8 | 134-273 | None |
| A0A3N4L9K4 | 5-129 | None |
| A0A3G2S584 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.