DPCstruct | MC21076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 185 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349BUD1 | 4-200 | LQYNTKRKQLIIPEYGRHIHLMIEQAKAETNIEERNKKANAIIGVMGNLNPHLRDVPDFQHKLWDQFFIMANFDIDVESPYEKPEKE… |
| H6L436 | 79-273 | HPSTYHTEKEPILVREFGRNMQAMILHTKAIEDAEERQAAIEHIVKLITNMYPDPQRSTEDYRIKIWSHILQICNYELEVDIPEEVP… |
| A0A078R424 | 1-161 | None |
| A1ZZ31 | 43-243 | None |
| A0A7Y5B9C1 | 5-212 | None |
| A0A1F3P690 | 17-212 | None |
| A0A354SLX5 | 27-221 | None |
| A0A662A124 | 1-178 | None |
| A0A7V9AP25 | 2-171 | None |
| A0A5J4Q8S8 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.