DPCstruct | MC21075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 390 ± 35 aa |
| Standard deviation of domain lengths | 34.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6JU03 | 2-338 | RRLHILYKENKLTETQESALEAAIWESCDGDGWPRDSQLHPWIYMDLPGYQRAVAIFKSTIVEPVSNGEISESLLLNLRAGLSLLEV… |
| A0A416PUJ5 | 66-462 | SASTLAKKYYEKANIDSTIIDDLIKCASESEEDYWAIIPRLNKLREWSLLSAEQLADLRELIWKNVNEDTGLPNFKEYYAAAFLKWP… |
| A0A415FEK1 | 10-373 | None |
| A0A4Q6DMQ2 | 227-677 | None |
| A0A844GMW2 | 791-1184 | None |
| A0A3E5E365 | 432-825 | None |
| A0A0D6AM77 | 632-1048 | None |
| A0A6G8PVQ0 | 73-528 | None |
| A0A3E4M0J6 | 122-488 | None |
| C6LK77 | 2-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.