DPCstruct | MC21071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 176 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4K651 | 144-340 | PPYSSMDQLVSHNIFPATYSADVRAMEFPWVKVQDRPWAHGRFKDLEFYNLVGFHVHYADDSLDDLVHMQLWTAGKGVSAGFHNHVE… |
| A0A821FFR6 | 5-165 | HNIQRNDDIRKVTIVNPLPEYYSPEVRQLVFQFVKNNRHEPKENFKDCEFYNLKGFEISFSDNDEHLCYMQLWAAGQSVNDDVHNHT… |
| A0A4Q4Y1G1 | 186-363 | None |
| A0A167A070 | 357-519 | None |
| A0A821HEZ8 | 1-195 | None |
| A0A391NS51 | 125-283 | None |
| A0A0M8N8K8 | 523-703 | None |
| A0A820CTW0 | 8-198 | None |
| A0A819UFL6 | 389-545 | None |
| A0A821KM17 | 118-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.