DPCstruct | MC21070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 183 ± 28 aa |
| Standard deviation of domain lengths | 27.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9NCW9 | 106-287 | LLHKNLNLFLNPGLLEAETVQHIFSNNYQLCSEISESVLQHFIHCLATHGRHVQYLNFLHTIIKAEGKYVKKCQDMIMTELTNSGED… |
| A0A821FDD3 | 4-167 | VETCCYIFLNNIQLCKTMTEKRIQHFVHLIELHGRKVIYIKFLQTIVKAENQYIKNCQDIIMSELVTSDEVLIFYEKGNLTNLFERM… |
| A0A6V7VMF0 | 89-260 | None |
| A0A6L5DFX7 | 330-503 | None |
| A0A1X7TEF3 | 719-918 | None |
| A0A1I8IQR2 | 339-524 | None |
| E9GAK9 | 68-185 | None |
| A0A1X7SS20 | 130-333 | None |
| A0A2I0TD92 | 150-305 | None |
| A0A821JXQ6 | 1045-1260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.