DPCstruct | MC2107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 274 ± 35 aa |
| Standard deviation of domain lengths | 35.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6YZ74 | 15-265 | GNPSLICTPPGPSDYIIFYFSNYFAHAATVIATPGQGNRETFLAILLALLIPGSGVSRAVDAIRRHSIFERDAVRRAIRAGALCMIV… |
| A0A1X6MY26 | 40-332 | APLGLDTSLYCPKNLDILWNLAKFLGTNYIAHAISVPLAAEVGRFTQRVTVRSPTHWAAIVSLFLPFGGLGRAILLVAEHLESLNDN… |
| A0A2T3ZP18 | 5-236 | None |
| A0A5M3MKV1 | 34-319 | None |
| A0A7R8A428 | 3-253 | None |
| L2FH58 | 43-357 | None |
| A0A6A5WFC6 | 27-328 | None |
| A0A395J208 | 2-253 | None |
| A0A178AC86 | 6-237 | None |
| A0A3N4KML6 | 8-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.