DPCstruct | MC21069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 206 ± 26 aa |
| Standard deviation of domain lengths | 26.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07814 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8VEH9 | 114-318 | RVASALPGLLKMSIHSQELALRFCCSVTNDNEENSGVFSQHQTIHLIMSLIIDGFSSRGTLSEEEASVSHDLLVLALGLMINLTSVC… |
| A0A821FCQ1 | 15-210 | NLFRLLVTIQQSSLTNEEQFDAVALTLNLLINLVKNTKDVYKHLMEDNMPGGSTTKIYEYLADVFCEQESLAAKAESQEENDWMMED… |
| M1VH51 | 602-824 | None |
| A0A139ATF3 | 28-285 | None |
| D8S2V3 | 560-754 | None |
| A0A7S3BB44 | 62-243 | None |
| A0A023FMV1 | 20-230 | None |
| A0A022RWQ8 | 256-468 | None |
| A0A0D8XFK1 | 496-701 | None |
| A0A5A9NNW5 | 876-1146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.