DPCstruct | MC21065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819Z371 | 1-87 | MDQPTSHLSNTNIDIDYTTPTVRYSVKNDETLKEGLTYLNENGYVVISDVLNQEEIDENKKLLWKFLEDASNGQMRRDQPETWSNPW |
| A0A821DBT1 | 1-76 | MNQIDYTTTSPRFSVTNNKELDEGLAYLNEHGYVVISDVMSQDEVNMNKELLWKFIENVSNGTIKRDDPETWSNQW |
| A0A817NXW1 | 1-82 | None |
| A0A817D798 | 1-87 | None |
| A0A818MSX6 | 1-77 | None |
| A0A814JVY4 | 15-95 | None |
| A0A818ZCG0 | 1-87 | None |
| A0A820GP14 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.