DPCstruct | MC21064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 69.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7XFU8 | 274-336 | LDRDGYPLGWPKHGYPAPQGPYYCGVGASKVFGREVVIAHYRACLHAGLAIFGINAEVTPGQW |
| A0A0D2QTE6 | 141-198 | WPIGWPLGGYPGPQGPYYCGVGVDKAYGRDIVDSHYKACLYAGINISGINGEVMPGQW |
| A0A445MGU8 | 85-153 | None |
| A0A261Y1Z2 | 142-196 | None |
| A0A815T6D4 | 464-528 | None |
| A0A820C2I5 | 73-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.