DPCstruct | MC21061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 218 |
|---|---|
| Mean domain length (aa) | 251 ± 60 aa |
| Standard deviation of domain lengths | 60.41 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.45 |
| Pfam Score | 99.29 |
| Assigned Pfam label(s) | CL0724- CL0052- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M8QU71 | 13-278 | ATHANTSAQQEADYLKGLDEALHAGYEILAKGGTALDAVERSVMALEDIPLFNAGRGAVFTSDEKHEMDAAVMCGKTLRAGAVSAIS… |
| A0A821CQY1 | 19-301 | FINATRNAFATLLTPGATCLDAVEVGCRTCEDEQCDGSVGWGSHPDENGETTLDALIMDGSTMSVGAVANLHRIKNAIGVARAVLRY… |
| A0A1V6S329 | 828-1096 | None |
| A0A3G4XL19 | 922-1184 | None |
| A0A3Q7T3T8 | 227-506 | None |
| H0EMJ7 | 307-561 | None |
| H0ER24 | 2-148 | None |
| A0A0P1B1S2 | 4-166 | None |
| A0A5N5TCY9 | 4-218 | None |
| A0A1X6PF64 | 32-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.