DPCstruct | MC21059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 208 ± 22 aa |
| Standard deviation of domain lengths | 22.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8LU07 | 105-303 | KSVIQRIIKEKHDDFEEDKKKYPGLDTLIFFKLASLIFPTSDFRHPVTTACAIFMSEILFRCRIKNKIDISKGLFICTLILEYTVLS… |
| U9UD11 | 2-214 | HLINRLSLQIYDLVQQIPEYTIKYFKEKIDYQKNSLVRNNKFPGITDLFLFKLFGKVFSTSDFHHNIITPTLLLIGQYLSQCQVING… |
| A0A3N0YKI3 | 690-894 | None |
| A0A182STH6 | 1-204 | None |
| A0A2U1JFQ3 | 796-1054 | None |
| G5B2F0 | 170-362 | None |
| A0A7S1V5W8 | 26-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.