DPCstruct | MC21057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 49 ± 3 aa |
| Standard deviation of domain lengths | 2.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 66.86 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0167- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I6CW60 | 1-47 | MIVIEDLKVSNMSKSAAGTVSLPGRNVRAKSGLNRSILDQGWYEMRR |
| N8U0X5 | 1-53 | MIVVEDLKVANMSKSAKGSIEEKGKNVKAKSGLNKSILDQGWSMLVNMLEYKQ |
| A0A0D8FYI7 | 5-51 | None |
| Q7N921 | 36-82 | None |
| A0A3N8LZX6 | 58-103 | None |
| A0A827DAJ0 | 107-157 | None |
| I6DI28 | 1-46 | None |
| B6VL87 | 1-53 | None |
| Q2JIC4 | 269-315 | None |
| A0A1X7A1A8 | 74-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.