DPCstruct | MC21053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 171 ± 22 aa |
| Standard deviation of domain lengths | 21.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5EZQ1 | 2-129 | PSPTAATAIQDLSNIDTDISALLSSASKALQCLSSPPTPGTDPTEEFRAHAEEYHRLLSSITVRLRRQIVQLQAAEIPVVSGTIDVG… |
| A0A1X7S7L1 | 6-181 | NTPTISPEERIRELSTINTNVAALLTSAGHAINSLTNRPLERNTSDEDTEMKDAAGNSPEDHKKAFAQHTTEFFEGLQGVVARLRRQ… |
| A0A7D8YZZ5 | 1-182 | None |
| A0A1Y6M0G0 | 6-181 | None |
| G0SH09 | 17-237 | None |
| A0A0G2H8K4 | 1-163 | None |
| A0A0F4GDN1 | 2-180 | None |
| H0EYY8 | 26-193 | None |
| A0A6A5VA52 | 13-170 | None |
| A0A0S6XBZ4 | 2-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.