DPCstruct | MC2105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.06 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | CL0369- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5KQ98 | 20-110 | EELPRCALCGRRIPSFARQSEHHLVPKSRGGTFGPTVLLHQICHNVIHALFSEKELAWRLSDIEALRAEPEVATFIAWVRSKPDDFH… |
| F5LJP6 | 6-96 | EQGTCELCGRHEVKRTEHHLTPKEKGGTFLPTAMLCIPCHKQIHALFTNEQLERDLHTLDALRGDERMRAFLKWIRKQPSASLPRVR… |
| A0A4Z0YZ41 | 196-289 | None |
| G3JCV2 | 86-168 | None |
| A0A7S2XRD7 | 140-251 | None |
| A0A1B7Y5G4 | 341-422 | None |
| A0A812UCS3 | 298-401 | None |
| M2SB47 | 1-74 | None |
| E3QLL5 | 10-100 | None |
| A0A6S7BEU1 | 12-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.