DPCstruct | MC21049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 340 ± 33 aa |
| Standard deviation of domain lengths | 33.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420S7G1 | 9-318 | PDGFCGVSRQQRIEDLLNLDTTELIELVFRPELYIQGHEIIWTENMLIPGNISYIKRALHGHLADDEKAQFLQRMRREHHLLIAGSA… |
| A0A366QT48 | 144-452 | KGEEVILHHSLTVPGNIRALKLLLLGKDWGRAFHGGDLTAEVAKDLAYQSARSLYHRRAPVILARIQPATTTQVPNYKKSDLKRCVI… |
| A0A366Q0F0 | 1-373 | None |
| A0A0F7ZHR4 | 164-538 | None |
| X0B0U2 | 2-331 | None |
| A0A2T4AQ49 | 17-299 | None |
| W9IIH8 | 113-503 | None |
| A0A0I9XBF8 | 1-374 | None |
| A0A098DUK6 | 141-468 | None |
| A0A1T3CHQ5 | 160-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.