DPCstruct | MC21045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 13.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 39.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420RKL0 | 1-130 | MEQFERLVDFLLGETEEPAASRSPLPFTATSENRWRWHTWDAMARYHIFRDKYERSVKPDKPTGCVKSAVDWPEIADELYLIGAMHD… |
| A0A2P5HID9 | 85-230 | DQCNGIYIHRTAAPKTLAPPTEKQFHDLITFLISPSSDSTTRCPLPIEVTVENKWRWDPYDGMTEHHIFKFRQEIPEDQPRTRCIRR… |
| A0A395SPZ9 | 125-273 | None |
| A0A2N6NW09 | 1-131 | None |
| A0A167YQ92 | 195-334 | None |
| C7ZJR8 | 209-324 | None |
| A0A2H3H1L7 | 772-893 | None |
| A0A2P5HZY5 | 104-218 | None |
| A0A366R496 | 726-837 | None |
| A0A0A2VKH2 | 100-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.