DPCstruct | MC21044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 185 ± 22 aa |
| Standard deviation of domain lengths | 22.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F2LWQ9 | 7-168 | HIGLSSQCVFGNHDSTAYRGCTRPFAFPHSGHIITKVDGLRLCRFADCKTCSLSPEYVPIHYECYEIFRASCSVKGTDALHRLWVVA… |
| A0A420RA58 | 13-199 | LDRMNDLSAKTKGHVYITPECGLCDQIIHANEWTVALLGNEDCLSPLYLTKKFRFPKSREAIKSVDELTLCQRLQCKMCDMAHLSVI… |
| A0A167PZT0 | 33-236 | None |
| A0A6V8QL81 | 1-233 | None |
| G0S3A0 | 23-197 | None |
| A0A5N5Q065 | 1-177 | None |
| A0A842Z8V3 | 2-207 | None |
| A0A167W9V1 | 323-514 | None |
| A0A0N0DAR3 | 2-152 | None |
| C7YMY3 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.