DPCstruct | MC2104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Standard deviation of domain lengths | 13.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2IEE1 | 77-236 | ALRPGEVAPGAAAGGGDAMDATADAHGAAQRRRALAHVATSRGRVDMPVAKASIVVPEHFRFIDRVALQRAFAGSGDGPGPRTVGWL… |
| F5LH47 | 1-128 | MKLPKLITLLTGAALCVSLWTAPASAEETLNWVEGPKKVGLGQIAELDLDKNFVFLNDTDTKKFEQQNDSHVNNREIGSVFPKDENQ… |
| A0A150HIZ6 | 29-166 | None |
| A0A2V6D964 | 2-154 | None |
| A0A257C716 | 73-235 | None |
| A0A6C2D5Z1 | 188-318 | None |
| A0A7Y3SIJ2 | 1-153 | None |
| A0A5S9N8C2 | 1-159 | None |
| A0A246Q4J9 | 36-193 | None |
| A0A6M6BE11 | 3-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.