DPCstruct | MC21039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 105 ± 25 aa |
| Standard deviation of domain lengths | 25.42 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8GJ96 | 197-284 | GGEAVSTMHILNHANQQGIPVYTINQDNVDSVLPQLEYDSAKKQEFRNLINNGKEITVPERDVTINGWNGTGYIVLNPDDGTGEYIIS |
| A0A1X9NDB8 | 6-143 | MDMDSMKFSTECKSNCQGKWRDFNQQMGATYSAYEHLIPEQLFSTDDDPVEGISAVKALAIAGQQGQRVYTFTQDNLSYLSDLTVDQ… |
| R5YP31 | 755-845 | None |
| A0A831Z6V2 | 106-209 | None |
| A0A6I1KMF9 | 378-459 | None |
| A0A829YA79 | 1-77 | None |
| A0A373PSV1 | 636-720 | None |
| F0Q7U8 | 90-215 | None |
| G8LWN6 | 741-848 | None |
| G8LY28 | 269-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.