DPCstruct | MC21038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 154 ± 9 aa |
| Standard deviation of domain lengths | 8.58 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1CKG2 | 14-158 | LSSTLAANININSGPVEFGQGVAQTVSCSGETALTVTPESEFANVNDGGAFYFKSVSVSNIPTSCYGKDFTIKAYGDSGNTPIVLFN… |
| A0A6I3GWK4 | 20-180 | GISVAFFISTIGIAVASLITLNTDNSIEFGQGVAQTTACDNSIVLAPYSTFDNSGVGEFKFSSISLSNVDSTIQEESGDPGCAFKTF… |
| A0A6J7GUV7 | 2-160 | None |
| A0A6J6DB21 | 30-187 | None |
| A0A6J6INU1 | 40-188 | None |
| A0A6J6AMC3 | 1-146 | None |
| A0A6I3H499 | 34-187 | None |
| A0A6I3GLY7 | 36-199 | None |
| A0A6J6LPL7 | 22-191 | None |
| A0A6J7A0I8 | 38-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.