DPCstruct | MC21034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4PJC5 | 424-509 | RRAAATTVNAAIITGIVPTGGGFYSGGAENYLRLLEDWRNITLTFNGSIAVLFPSTVANAPWGALDDVYYPPRRQFSPDTYLMDGS |
| A0A2T3W731 | 3-128 | RLADDTTINAAILAGTATTVAERQIFNDLASDLQSGGVHNMMRFHEEWGANNGHPNGIQPYNYRGSLVSLDRPLHAFGSFRVGQPTY… |
| A0A7Y4WXZ5 | 577-716 | None |
| A0A0S8J970 | 17-123 | None |
| A0A2V9CV70 | 614-743 | None |
| A0A7X1E6Z8 | 102-211 | None |
| A0A7C5CXB2 | 232-336 | None |
| A0A2V5VJI7 | 158-260 | None |
| A0A660Q573 | 1-109 | None |
| B4DCI4 | 6-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.