DPCstruct | MC21031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5UGL2 | 51-137 | VNSNKHRISRAYRKYKSENAALPSIAVCNVVVRSSDSLHRGVEIGLNKQLFSNDSSLFSMVNGINELLTYCKFNQYHDFIITDFLYF |
| A0A415SV62 | 104-186 | LEATINSMYTKYCTENGYEPHFADCAIKWKDTQETVEVRIFLSSGVYDEIDDEIFYYCDGLHDFIALVGSGVEDFTIVQCFYF |
| A0A255SMT2 | 4-84 | None |
| A0A412SC38 | 168-249 | None |
| A0A060R9W9 | 104-185 | None |
| A0A4Y9IIF4 | 12-94 | None |
| A0A3R6MPF1 | 2-97 | None |
| A6KY50 | 53-140 | None |
| F0R5L3 | 74-164 | None |
| A0A7Y4Z9K0 | 14-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.