DPCstruct | MC21027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 254 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 56.67 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF02365- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1N8M8 | 128-338 | FPHDHSLSIVRLKQVYKILQYIEAYQEEHKLGPMPIILCGDWNGSKRGQVYKFLRSQGFVSSYDTAHQYSDSEEDAHKWVSHRNHRG… |
| A0A7C8ZZI5 | 1-277 | FPHDSSLSLVRLHQVYEILQNVEAYQKEHKLNSMPIMLCGDWNGSKRGHVYKFLRSQGFVSSYDTAHQYADADAHRWISHRNHLGNI… |
| A0A1R3IIB2 | 194-455 | None |
| A0A6D2K836 | 80-343 | None |
| A0A835UBS7 | 1-230 | None |
| A0A6D2HPT7 | 107-309 | None |
| A0A6A6MPH2 | 459-698 | None |
| A0A2R6WDR1 | 187-498 | None |
| A0A6A2YZU5 | 31-289 | None |
| A0A834U1Z0 | 341-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.