DPCstruct | MC21025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0Y4J6 | 63-174 | YTDKWAERSEGDGWSKWGDKWDEHFDPNGHGVKQGETWWAGKYGDRWNRTWGEHHNCTGWVHKYGRSSSGEHWDTHVPQDTWYERFP… |
| A0A7C8ZSS1 | 1-96 | GDKWEDKFFAGIGSRQGETWHVSPSGERWSRTWGEEHFGNGKVHKYGKSTTGESWDIVVDEGTYYEAEPHYGWADVVGDSTQLLSIQ… |
| A0A2G5DTW2 | 115-231 | None |
| A0A835IU13 | 1-102 | None |
| A0A6A2WLB5 | 313-411 | None |
| A0A388KXT4 | 750-847 | None |
| A0A6T5WP31 | 61-149 | None |
| A0A444D0I9 | 154-254 | None |
| A0A3Q7GCD7 | 351-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.