DPCstruct | MC21024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 37.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7KB29 | 7-115 | RPYTRTVTNWKFPKFYPEKVMCVTVFPSLDEEFISFARCIKVSELVGIKKVERYFPNRVATQFGMLQDIPSSVDKNNLSREAAWNDY… |
| A0A7G2E1W9 | 313-423 | MDSFEWRPYTKTVKNWDFPRFYPERAMRVPVGPNLDDEFISFARCIKVSELVGIDSVEHYFPNRVASQFGMRQDVHCPVNQKKLSRD… |
| A0A1R3IGP7 | 33-137 | None |
| A0A6N2KA70 | 3-80 | None |
| A0A1R3KYP4 | 158-265 | None |
| A0A834FU46 | 81-188 | None |
| A0A2P6QC08 | 149-265 | None |
| A0A2P6QBY7 | 1-100 | None |
| A0A6L2MFP7 | 381-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.