DPCstruct | MC21023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 178 ± 36 aa |
| Standard deviation of domain lengths | 36.31 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.64 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0271- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139ALV1 | 8-129 | RQAYFGSLRDSKRQWITTEELCSFTWNFRMKDASGSHFTDLDPWWNYEPARTRLYNPDGTMGGTVYRPDARWRFVPTGGGIVAPHEG… |
| A0A7C8ZNK6 | 13-172 | ESLMDNKCDQLWIGKAHIPRWAEVPGLSKLARYSRAVIDSKRVRIMREDLCDHAWDFHFTEAAPPYWKNLDPYWGGAGRPMRRYFHP… |
| A0A317SWP8 | 1-206 | None |
| A0A7S4HIT8 | 7-137 | None |
| B8CA08 | 150-350 | None |
| A0A7S4E883 | 28-188 | None |
| A0A7S0MIA4 | 20-220 | None |
| A0A4S4DC62 | 53-232 | None |
| A0A2P6NM59 | 69-267 | None |
| A0A812PAN5 | 153-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.