DPCstruct | MC21022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 7 aa |
| Standard deviation of domain lengths | 7.15 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2DS38 | 487-610 | MMTVKHWSQDASYTLTSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNPGPLQYDGPGADAKAVSLCVEDQDYMGRIKKLQE… |
| D8M8M2 | 86-197 | CTVEAKQGVYRPSIPESNVNMNDAPFLKFVAHRDSWTVKDETCNPGSVQFGGAGSWNTTLSLQIEKHDYLKRIQLLRDELKAVEKIC… |
| A0A0E0K4D4 | 298-428 | None |
| A0A453PE81 | 81-210 | None |
| A0A835N2H6 | 1-131 | None |
| A0A287WCR1 | 215-345 | None |
| A0A835DNR0 | 538-658 | None |
| A0A7J0DIU2 | 731-861 | None |
| A0A7S0BBY8 | 48-172 | None |
| A0A836C8A1 | 65-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.