DPCstruct | MC21021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 184 ± 18 aa |
| Standard deviation of domain lengths | 18.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287UDF1 | 11-168 | GLDPMMDALQSPSRWPLEFERKQQEIIELWHACSISLVHRTYFFLLFKGESADSIYMEVELRRLLFLRDTYSRGSTPSNVVVGSLSS… |
| A0A7C8ZHT3 | 2-187 | APSIMQSPLNWHEEFEIQRVRIIELWHECLVPLVHRTYFFLLFKGDPSDKLYIEVELRRLSFIQERFSQGQRIVLDGQVFTRALSIR… |
| A0A444CCM8 | 245-424 | None |
| A0A6A3AWE4 | 417-610 | None |
| A0A6A4PT27 | 109-291 | None |
| A0A0D3DSH6 | 18-211 | None |
| A0A446MJI4 | 398-592 | None |
| A0A2G5EN34 | 984-1172 | None |
| A0A078GCH8 | 216-402 | None |
| C0HE28 | 98-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.