DPCstruct | MC21019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0281 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8N3M8 | 76-165 | MRRAFSEGDMKTLGNGNVSVIHSPLERPIIFSSCSTKDRREKLSRYRNKKTKRNFGRKIKYACRKALADCQPRIRGRFAKTEESNNS… |
| A0A7C8ZE57 | 1-139 | DLDISQVRRVFSTGDLDKGVNNPHHHQHRERSPLANESTSIILEGMTRACRYNPEEKRERIERYRSKRSQRNFNKKIQYACRKTLAD… |
| A0A3B5YV87 | 263-388 | None |
| A0A287RII0 | 1-129 | None |
| A0A7J7FRE5 | 26-149 | None |
| A0A6A6N0M5 | 16-147 | None |
| A0A833VVA4 | 15-136 | None |
| O82117 | 210-334 | None |
| A0A151TN21 | 113-242 | None |
| A0A804LPB7 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.