DPCstruct | MC21017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Standard deviation of domain lengths | 16.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4A0H7 | 91-222 | GDSSSDLLKQIEKKESVAYVEKRAVMRDWLKALFRGQAYATIGLSFLLSYDLIPFVDLDLSIRVLGFWSWWLFTVPSLRSIKPLPAP… |
| A0A7C8ZAL9 | 60-193 | VVNKTAATFAPRASTARKNPAIPGTALYTIFEVQGYASMLMGGVLSFNLLFPSTEPDIWRLMGMWSIWMFTIPSLRARDCSNNEKEA… |
| A0A7S4P370 | 184-325 | None |
| T1M2Q9 | 9-152 | None |
| A0A2N9GVG3 | 586-748 | None |
| W7TZ94 | 118-261 | None |
| A0A061S3G0 | 95-220 | None |
| A0A1Y5IL61 | 6-130 | None |
| R1EB73 | 51-174 | None |
| A0A0G4GG26 | 153-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.