DPCstruct | MC21015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 130 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661KTG8 | 12-132 | GKAEEPNLLQKILSMTVQERKDFWDKQFMKCIKCYGCIDVCPVKREEPEELSLSKWIEKAKVPPPYPAFHLLRAYQVWDTCILCGEC… |
| A0A7C2DZJ2 | 35-160 | SREVIEKLESLPEKERLEWWKGQFRRCVKCYGCRNICPMCFCKDCALEDPHLVEPGVIPPEFPAFHVIRALDMAGRCIDCGLCEEAC… |
| A0A1I4QWQ6 | 101-208 | None |
| A0A7R9RDC2 | 81-240 | None |
| A0A7V0XEC3 | 184-312 | None |
| A0A2N3G544 | 125-218 | None |
| A0A7Z9ZG54 | 291-448 | None |
| A0A7C1BMI4 | 23-162 | None |
| A0A847EHE4 | 43-181 | None |
| A0A1V5DZH6 | 20-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.