DPCstruct | MC21014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 526 ± 63 aa |
| Standard deviation of domain lengths | 63.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7VU62 | 6-578 | SQSATLSSVAIDELFGSVLNNDPKLLAFTDSVQDASHRAGFFTARTYQFTFRTALQHVIDGAGTAGIRLVDAGKALLDWWSEPRPGW… |
| A0A7C2DDW5 | 560-1099 | SPTAATVSALATHHLDGLDGDDHKLLVFADNRQDAAHQAGYSADRHRAFAVRHLIEAMVREAGPEGLALEDVPQRLLDKFREIRLVL… |
| A0A2W4YK44 | 24-605 | None |
| A0A485AQ51 | 3-451 | None |
| A0A1G6T6E2 | 43-461 | None |
| A0A6G6ANE5 | 2-471 | None |
| A0A376E1Y4 | 90-731 | None |
| A0A7G2J071 | 2-513 | None |
| A0A267TJW4 | 16-552 | None |
| A0A7C5ZWD1 | 7-544 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.