DPCstruct | MC21011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 181 ± 28 aa |
| Standard deviation of domain lengths | 28.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5DFX6 | 2-135 | MSLLVLGIVVIAPNLKAYIEQRQQIAQLEASVAESEDEIERLSVERERWNDSTYVMTQARDRLFYVNPGEVSFIVLNDVDSALLGKD… |
| A0A0Q7PVL1 | 1-187 | MAERRPNRGSGPRGTRRPTSPRGSRPRPGAVATPGTSPRRPAARRTPVRPKLTGRGTVLVLVLAVLTVSFASSMRAYLEQQSHISDL… |
| A0A1R4I7S9 | 1-175 | None |
| A0A0Q6FKW2 | 2-138 | None |
| A0A328LH75 | 37-241 | None |
| A0A1D9ML48 | 19-210 | None |
| A0A5M9ZTF5 | 5-194 | None |
| A0A542Y596 | 16-144 | None |
| A0A6I3J1D7 | 2-187 | None |
| A0A421AXA0 | 2-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.