DPCstruct | MC21001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 216 ± 25 aa |
| Standard deviation of domain lengths | 24.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9SSE7 | 9-229 | DVPGEEEAGWVTAAVDAIPAPGSGTARPWKLSIGTLLARHPRTPRGAGRVLGLLDRFGAIEFGPRKVGFDGDDASWEKVIEIRTRTV… |
| A0A3C2B338 | 6-208 | AEDDDLAAGDDLGDPNERRSQWQDVLTAFRAPTIPIVEPWSISIATLIGSAYKVPSIASKALAQLDRVGALRLTSEAITFDTDDVEW… |
| A0A1V2PFJ1 | 7-184 | None |
| A0A1H6IGP2 | 27-237 | None |
| A0A2A3I8N2 | 34-249 | None |
| C7Q9N1 | 19-197 | None |
| A0A7W7VC14 | 201-422 | None |
| A0A4Y4DWG5 | 116-351 | None |
| A0A2M9CC28 | 22-286 | None |
| A0A6N4V8S8 | 28-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.