DPCstruct | MC21000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9SPE6 | 1-140 | MRRCAFLLCVALVASGCSVTRTISAGAYRVAVTDGTIAELGSLGLTLHERPACHMPRTESPTVVRITCTGRTDTGRAVRVEGLVTAA… |
| A0A3M2LLZ2 | 34-129 | KELRYRSQNALRNGIARVGGEELAHRGVSLDSTLNCADSPGWTKRKMRVTCTSSTSDHRQVQIIGAGEDATQDQYYTILVDGRPLVQ… |
| A0A853BRQ6 | 579-707 | None |
| A0A4P6Q603 | 1-146 | None |
| A0A4Z0G9Q1 | 3-145 | None |
| A0A161R930 | 15-115 | None |
| A0A7W8QIA8 | 5-156 | None |
| A0A7J9ZGP4 | 1-110 | None |
| A0A845BP69 | 1-103 | None |
| A0A5C7P246 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.