DPCstruct | MC2100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 45.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358KMB7 | 10-90 | LMKRRFYILCFIIVGFLLQLLVHALVEKWYISLLIKDFSTYGLGWSWDTWFSIHSVATVLLTIFGLVFGYWQGRYWWPRLY |
| A0A2H0TDV1 | 1-85 | MQIKRVLYVVSFVVLGCLLQLLIHAGVEMWYISLLLRDFPRFSLGFSWEIWFLIHHIGAGVLFVAGIVFGWWQGHYWWKRIYEKK |
| A0A1G2F5X2 | 1-97 | None |
| A0A0G1KLZ8 | 51-132 | None |
| A0A2M8KVX5 | 2-83 | None |
| A0A1F5X0Q6 | 1-82 | None |
| A0A0G1H4V9 | 11-94 | None |
| A0A1G1Z8L4 | 24-104 | None |
| A0A1G2HEF2 | 1-92 | None |
| A0A1G2KQC8 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.