DPCstruct | MC210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 174 ± 16 aa |
| Standard deviation of domain lengths | 15.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G7Z0Y6 | 3-191 | TKTARTTSVTIPMDSAHETTFLEARQALDSVAEHLLATYPARVDQAAARAGVMRDDPEGRARIAATVLAEDEKTIGDLQDTAEKALE… |
| A0A2P8DHL1 | 1-202 | MSDAESILAKLNVSLAEVTVPLYLNGRLYADWQDAQRELTDRQQQHRASADSLAGDPEARRLAKRVDELEEQVRQSRAIVRLRSLGR… |
| A0A1M3LPE1 | 2-177 | None |
| A0A086GRJ9 | 1-152 | None |
| A0A6G7XBQ3 | 22-210 | None |
| A0A2W1PZA5 | 2-149 | None |
| A0A1I3LQR9 | 27-206 | None |
| A0A4R7T2W8 | 4-196 | None |
| A0A7J5DVB5 | 4-184 | None |
| A0A021VU43 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.