DPCstruct | MC21
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 180 ± 52 aa |
| Standard deviation of domain lengths | 51.64 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5ELL4 | 4-166 | YKQIFMVFLKMGAFAFGGVYAMLAFFQRELVDKRKWLKQDEFAEGMAIGQMTPGPPIINTGIYVGYHLKGPKGALAATAGQVLPGFV… |
| A0A5D8QFE3 | 3-165 | LLRLFYSFFKIGAFSFGGGYAVLAFIQKEIVNLNHWLLPSEFVDVVAISQITPGPIAINAATFVGYKVAGYPGSAVATLGVTLPSFL… |
| A0A1E3GY99 | 26-140 | None |
| A0A1H3X6E1 | 18-118 | None |
| A0A433DIP1 | 286-438 | None |
| A0A7I6J2H4 | 4-214 | None |
| A0A7W1LB69 | 2-159 | None |
| A0A1F4A5M9 | 135-230 | None |
| A0A1L8ZFA0 | 1-120 | None |
| A0A7S1KKA3 | 212-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.