DPCstruct | MC20996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 24.06 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6B7C6 | 1-108 | MNEIVVKGSDIIILAILVLAVGNGITQKFSLLRKFSIPIAVTGGLLCGIAVALIATFGGPKIVFDLIIRDTLLMVFFTTIGISAKFS… |
| C0AUI2 | 4-127 | LDVYGTLVAATLVLLIGRKLVKSVPFLERYTIPEPVAGGLLVAVLLLASKSFMDWEVSFDLSLKDPLMLAFFATIGLNANLASLKAG… |
| A0A3G7U4V9 | 1-176 | None |
| A0A644U3I3 | 2-189 | None |
| A0A1V0DIA8 | 19-186 | None |
| R6ACV8 | 1-155 | None |
| H1D945 | 19-186 | None |
| A0A6D0R4Q6 | 16-196 | None |
| A0A377TL97 | 3-160 | None |
| A0A1H6PH99 | 3-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.