DPCstruct | MC20995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 129 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.32 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0273- PF05235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447JC19 | 63-185 | SVQPLFSTDFYREKWCLDVDGSRIEIALDLGDVKAGEFAEPICELELELLRGDTRAVLKLAKQLLSQTGLRQGSLSKAARGYHLAQG… |
| C0ATA2 | 1-148 | MLFHTDFYREIWLVEYQDSQIEVVLDQGAIRTEQYELPIEEFELELKKGKVSDVIALATYLGEKGGLRLASRSKAARGYYLAKDKPA… |
| A0A7K0F3N9 | 1-132 | None |
| A0A1B8P650 | 14-128 | None |
| A0A0H2YE52 | 119-253 | None |
| A0A5C6TY85 | 120-242 | None |
| A0A3L7LTS1 | 82-181 | None |
| A0A0S2SN04 | 82-202 | None |
| A0A560FPF4 | 176-309 | None |
| M5DVU3 | 116-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.