DPCstruct | MC20993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 123 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 71.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090PMH9 | 145-275 | QKVDLKNIDIFSYGPEQKCLVGSVDLVYRNSWHEVRTLHFKGETAMLDALKTVLGKMHQDALPPESVDVFCYSKNMRGVMRNMVYQL… |
| C0ARX5 | 1-131 | MVHFDFRKLDVFSFGEKEQCLIGSIDLLYRNSWNEVRTLHFSGTQSMLESLKTILGKMHQDAAPPASVEVFCYSQHLRGLIRTRVQQ… |
| A0A376YK75 | 45-164 | None |
| A0A6L2ZQ34 | 577-704 | None |
| A0A6M1HV82 | 28-156 | None |
| A0A6I4KMG4 | 347-459 | None |
| A0A380QEA4 | 389-501 | None |
| A0A3B0LZX6 | 575-701 | None |
| A0A090RNR9 | 1-106 | None |
| A0A0B8Q1A2 | 86-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.